Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO47 Peptide - N-terminal region

FBXO47 Peptide - N-terminal region

Product Specifications

UniProt

Q5MNV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO47 Rabbit Polyclonal Antibody (orb586827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008777

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-L1TD1 Antibody
CTA4620-01 30 µL

Anti-L1TD1 Antibody

Sign In for Pricing
View Details
Anti-L1TD1 Antibody
CTA4620-02 50 μL

Anti-L1TD1 Antibody

Sign In for Pricing
View Details
Anti-L1TD1 Antibody
CTA4620-03 100 µL

Anti-L1TD1 Antibody

Sign In for Pricing
View Details
Anti-L1TD1 Antibody
CTA4620-04 200 µL

Anti-L1TD1 Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
orb3053636-01 50 µL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
orb3053636-02 100 µL

FCGR2B Antibody

Sign In for Pricing
View Details