Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO47 Peptide - N-terminal region

FBXO47 Peptide - N-terminal region

Product Specifications

UniProt

Q5MNV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO47 Rabbit Polyclonal Antibody (orb586827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008777

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBC3 Antibody
CSB-PA620085-01 50 μL

BBC3 Antibody

Sign In for Pricing
View Details
BBC3 Antibody
CSB-PA620085-02 100 µL

BBC3 Antibody

Sign In for Pricing
View Details
N- (3-Aminophenyl) furan-3-carboxamide
BMB21287-01 250 mg

N- (3-Aminophenyl) furan-3-carboxamide

Sign In for Pricing
View Details
N- (3-Aminophenyl) furan-3-carboxamide
BMB21287-02 2.5 g

N- (3-Aminophenyl) furan-3-carboxamide

Sign In for Pricing
View Details
Monoclonal Antibody to Hepcidin (Hepc)
TRV-0052755-01 20 µL

Monoclonal Antibody to Hepcidin (Hepc)

Sign In for Pricing
View Details
Monoclonal Antibody to Hepcidin (Hepc)
TRV-0052755-02 100 µL

Monoclonal Antibody to Hepcidin (Hepc)

Sign In for Pricing
View Details