Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC5 Peptide - N-terminal region

ARMC5 Peptide - N-terminal region

Product Specifications

UniProt

E7EMQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC5 Rabbit Polyclonal Antibody (orb587136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5 Protein (Native, Human)
P522505 100 µg

C5 Protein (Native, Human)

Sign In for Pricing
View Details
FKBP5 (FK506 Binding Protein 5, FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10) (Biotin)
MBS6173646-01 0.1 mL

FKBP5 (FK506 Binding Protein 5, FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10) (Biotin)

Sign In for Pricing
View Details
FKBP5 (FK506 Binding Protein 5, FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10) (Biotin)
MBS6173646-02 5x 0.1 mL

FKBP5 (FK506 Binding Protein 5, FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10) (Biotin)

Sign In for Pricing
View Details
IgG, H&L (APC) discontinued
I1903-86A-APC 100 µL

IgG, H&L (APC) discontinued

Sign In for Pricing
View Details
YOR396C-A Antibody
orb853271 2 mg

YOR396C-A Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal LMBRD2 Antibody [DyLight 405]
NBP3-06641V 0.1 mL

Rabbit Polyclonal LMBRD2 Antibody [DyLight 405]

Sign In for Pricing
View Details