CDRT15L2 Peptide - N-terminal region
CDRT15L2 Peptide - N-terminal region
Product Specifications
UniProt
A8MXV6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDRT15L2 Rabbit Polyclonal Antibody (orb587268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001177719
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTHAPGPYADIAALAAPAVEPKPAWEEPPPERALEVEGAPAKDQPSQELP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740096-500 1x 500 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details