Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT55 Peptide - N-terminal region

CT55 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CXorf48, BJHCC20A

UniProt

Q8WUE5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT55 Rabbit Polyclonal Antibody (orb587351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060333

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk2, phosphorylated (T68) (Serine/threonine-Protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CHEK2, CDS1, CHK2, RAD53) discontinued
221696-01 50 µL

Chk2, phosphorylated (T68) (Serine/threonine-Protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CHEK2, CDS1, CHK2, RAD53) discontinued

Sign In for Pricing
View Details
Chk2, phosphorylated (T68) (Serine/threonine-Protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CHEK2, CDS1, CHK2, RAD53) discontinued
221696-02 100 µL

Chk2, phosphorylated (T68) (Serine/threonine-Protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CHEK2, CDS1, CHK2, RAD53) discontinued

Sign In for Pricing
View Details
CJ085 rabbit pAb
ES19023-01 50 µL

CJ085 rabbit pAb

Sign In for Pricing
View Details
CJ085 rabbit pAb
ES19023-02 100 µL

CJ085 rabbit pAb

Sign In for Pricing
View Details
Lrguk AAV siRNA Pooled Vector
27593164 1.0 µg

Lrguk AAV siRNA Pooled Vector

Sign In for Pricing
View Details
POMP Blocking Peptide (C-term)
MBS9229061-01 0.5 mg

POMP Blocking Peptide (C-term)

Sign In for Pricing
View Details