DHRS12 Peptide - middle region
DHRS12 Peptide - middle region
Product Specifications
Product Name Alternative
SDR40C1
UniProt
A0PJE2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DHRS12 Rabbit Polyclonal Antibody (orb587359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078981
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FC169817 5000 mg
(3- (2-Chlorophenyl) -5-methylisoxazol-4-yl) -N- (2-nitrilophenyl) formamide
Sign In for Pricing
View Details RDR-MTNR1A-Hu-96Tests 96 Tests
Human Melatonin Receptor 1A (MTNR1A) ELISA Kit
Sign In for Pricing
View Details LV655783 1.0 µg DNA
PLOD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details