Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS12 Peptide - middle region

DHRS12 Peptide - middle region

Product Specifications

Product Name Alternative

SDR40C1

UniProt

A0PJE2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRS12 Rabbit Polyclonal Antibody (orb587359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078981

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ptma activation kit by CRISPRa
GA203465 1 Kit

Mouse Ptma activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF93 (BC020837) Human Untagged Clone
SC106184 10 µg

ZNF93 (BC020837) Human Untagged Clone

Sign In for Pricing
View Details
HEXA Rabbit Polyclonal Antibody (Fluoro550)
orb3081798 100 µg

HEXA Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti-CHD3 antibody
STJ111133 100 µl

Anti-CHD3 antibody

Sign In for Pricing
View Details
PROP1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1726903 1.0 µg DNA

PROP1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Hsa-miR-4716-5p miRNA Agomir
CMJ1559-01 5 nmol

Hsa-miR-4716-5p miRNA Agomir

Sign In for Pricing
View Details