Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS3L Peptide - N-terminal region

DUS3L Peptide - N-terminal region

Product Specifications

UniProt

Q96G46

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUS3L Rabbit Polyclonal Antibody (orb326969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PD-L2/CD273 Protein (His & Avi Tag)
PKSH033795-01 20 µg

Recombinant Human PD-L2/CD273 Protein (His & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human PD-L2/CD273 Protein (His & Avi Tag)
PKSH033795-02 100 µg

Recombinant Human PD-L2/CD273 Protein (His & Avi Tag)

Sign In for Pricing
View Details
n-Myc (MYCN) Human Gene Knockout Kit (CRISPR)
KN401241 1 Kit

n-Myc (MYCN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL
BNC882314-500 1x 500 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSY2 Mouse Monoclonal Antibody [A2-B9-G6]
EM1701-40 100 µL

MSY2 Mouse Monoclonal Antibody [A2-B9-G6]

Sign In for Pricing
View Details
CNPase Antibody
KC-2964-01 50 μL

CNPase Antibody

Sign In for Pricing
View Details