DUS3L Peptide - N-terminal region
DUS3L Peptide - N-terminal region
Product Specifications
UniProt
Q96G46
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUS3L Rabbit Polyclonal Antibody (orb326969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP720163XL 1 mg
HIP2 (UBE2K) (NM_001111113) Human Recombinant Protein
Sign In for Pricing
View Details 
