DUX4L2 Peptide - C-terminal region
DUX4L2 Peptide - C-terminal region
Product Specifications
UniProt
P0CJ85
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUX4L2 Rabbit Polyclonal Antibody (orb587367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
115100V0-AAT 100 Tests
MFluor™ Red 700 Anti-human CD151 Antibody *50-6*
Sign In for Pricing
View Details