Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUX4L2 Peptide - C-terminal region

DUX4L2 Peptide - C-terminal region

Product Specifications

UniProt

P0CJ85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUX4L2 Rabbit Polyclonal Antibody (orb587367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELLS antibody
70R-17718 50 ul

HELLS antibody

Sign In for Pricing
View Details
C9orf75 Polyclonal Antibody, Cy3 Conjugated
bs-15341R-Cy3 100 µL

C9orf75 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal GRCC10 Antibody [DyLight 350]
NBP2-97383UV 0.1 mL

Rabbit Polyclonal GRCC10 Antibody [DyLight 350]

Sign In for Pricing
View Details
Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)
MBS1229318 Inquire

Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)

Sign In for Pricing
View Details
LARP1 (A-8) HRP
sc-515873 HRP 200 µg/mL

LARP1 (A-8) HRP

Sign In for Pricing
View Details
RN5S41 Protein Vector (Human) (pPB-C-His)
PV117302 500 ng

RN5S41 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details