EFCAB1 Peptide - middle region
EFCAB1 Peptide - middle region
Product Specifications
UniProt
Q9HAE3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EFCAB1 Rabbit Polyclonal Antibody (orb587371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078869
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEI
More Discoveries
Explore Other Products
Browse additional items from our catalog
040277-ML550 100 µL
POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
43425111 3x 1.0 µg
SERF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details