Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFR3A Peptide - C-terminal region

EFR3A Peptide - C-terminal region

Product Specifications

UniProt

Q14156

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFR3A Rabbit Polyclonal Antibody (orb587373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESKANLLHDRLAQILELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRWD1 (NM_152892) Human Recombinant Protein
TP307141M 100 µg

LRWD1 (NM_152892) Human Recombinant Protein

Sign In for Pricing
View Details
PSMA3 Polyclonal Antibody
E-AB-52718-01 20 µL

PSMA3 Polyclonal Antibody

Sign In for Pricing
View Details
PSMA3 Polyclonal Antibody
E-AB-52718-02 60 µL

PSMA3 Polyclonal Antibody

Sign In for Pricing
View Details
PSMA3 Polyclonal Antibody
E-AB-52718-03 120 µL

PSMA3 Polyclonal Antibody

Sign In for Pricing
View Details
PSMA3 Polyclonal Antibody
E-AB-52718-04 200 µL

PSMA3 Polyclonal Antibody

Sign In for Pricing
View Details
S100A1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]
CF807339 100 µg

S100A1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]

Sign In for Pricing
View Details