EFR3A Peptide - C-terminal region
EFR3A Peptide - C-terminal region
Product Specifications
UniProt
Q14156
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EFR3A Rabbit Polyclonal Antibody (orb587373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055952
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESKANLLHDRLAQILELT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![S100A4 Recombinant Rabbit Monoclonal Antibody [SD200-08]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b03/imageurl/et1612-13.webp)
ET1612-13 100 µL
S100A4 Recombinant Rabbit Monoclonal Antibody [SD200-08]
Sign In for Pricing
View Details 
![NDUFB9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A1]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1a29/imageurl/ta502482bm.webp)
TA502482BM 100 µL
NDUFB9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A1]
Sign In for Pricing
View Details 