EML5 Peptide - middle region
EML5 Peptide - middle region
Product Specifications
UniProt
H0YJS1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EML5 Rabbit Polyclonal Antibody (orb326970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGPVFAMYTT LRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(R)-[2,2'-Bis(diphenylphosphino)-1,1'-binaphthyl]dichlororuthenium](https://cdn.genprice.uk/products/572/5295357208921/imageurl/trc-b675395-10mg.webp)
TRC-B675395-10MG 10 mg
(R)-[2,2'-Bis(diphenylphosphino)-1,1'-binaphthyl]dichlororuthenium
Sign In for Pricing
View Details 
BNC472251-100 1x 100 µL
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN421382 1 Kit
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details