EML5 Peptide - middle region
EML5 Peptide - middle region
Product Specifications
UniProt
H0YJS1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EML5 Rabbit Polyclonal Antibody (orb326970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGPVFAMYTT LRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RPAIN Mouse Monoclonal Antibody [Clone ID: OTI4A9]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9088e4/imageurl/cf810599.webp)
