Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESPNL Peptide - C-terminal region

ESPNL Peptide - C-terminal region

Product Specifications

UniProt

Q6ZVH7

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ESPNL Rabbit Polyclonal Antibody (orb587381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919288

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGRKSGLTLLGPLPHAAVPCSGPEPTAQRLGSRSQQGSFNGEDICGYIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-human CD185 (CXCR5)
E16FHF185-025 25 Tests

FITC anti-human CD185 (CXCR5)

Sign In for Pricing
View Details
Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)
TRV-0013568-01 10 µg

Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)

Sign In for Pricing
View Details
Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)
TRV-0013568-02 50 µg

Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)

Sign In for Pricing
View Details
Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)
TRV-0013568-03 100 µg

Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)

Sign In for Pricing
View Details
Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)
TRV-0013568-04 200 µg

Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)

Sign In for Pricing
View Details
Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)
TRV-0013568-05 500 µg

Recombinant Proteasome Subunit Alpha Type 7 (PSMa7)

Sign In for Pricing
View Details