Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESPNL Peptide - C-terminal region

ESPNL Peptide - C-terminal region

Product Specifications

UniProt

Q6ZVH7

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ESPNL Rabbit Polyclonal Antibody (orb587381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919288

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGRKSGLTLLGPLPHAAVPCSGPEPTAQRLGSRSQQGSFNGEDICGYIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Procollagen type IIA Polyclonal Antibody, APC-Cy7 Conjugated
bs-11069R-APC-Cy7 100 µL

Procollagen type IIA Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
UBE2C Rabbit Monoclonal Antibody
E49Y8515 100 µL

UBE2C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MPP1 (NM_001166462) Human Tagged ORF Clone
RC230084 10 µg

MPP1 (NM_001166462) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C20orf197 (C20orf197)
CSB-EP822688HU-01 20 µg

Recombinant Human Uncharacterized protein C20orf197 (C20orf197)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C20orf197 (C20orf197)
CSB-EP822688HU-02 100 µg

Recombinant Human Uncharacterized protein C20orf197 (C20orf197)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C20orf197 (C20orf197)
CSB-EP822688HU-03 1 mg

Recombinant Human Uncharacterized protein C20orf197 (C20orf197)

Sign In for Pricing
View Details