Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASHC2A Peptide - C-terminal region

WASHC2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM21A, FAM21B, bA98I6.1, bA56A21.1

UniProt

Q5SNT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WASHC2A Rabbit Polyclonal Antibody (orb55731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKVEAKSIFDDDMDDIFSTGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal GSTA1 Antibody (monoclonal) (M08), Clone: 1F9
AMM05233G 0.1mg

Monoclonal GSTA1 Antibody (monoclonal) (M08), Clone: 1F9

Sign In for Pricing
View Details
POLG Rabbit Polyclonal Antibody (Cy5)
orb923094 100 µL

POLG Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Kemerovo virus PCR kit
PCR-VH057-48R 50T

Kemerovo virus PCR kit

Sign In for Pricing
View Details
OAED00382-100UG - NUCB2 Antibody
OAED00382-100UG 100 µg

OAED00382-100UG - NUCB2 Antibody

Sign In for Pricing
View Details
Endou sgRNA CRISPR Lentivector (Rat) (Target 3)
K6202704 1.0 µg DNA

Endou sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral human NOLC1 shRNA (UAS) - Lentiviral human NOLC1 shRNA (UAS, RFP) (100)
GTR15115992 1 Vial

Lentiviral human NOLC1 shRNA (UAS) - Lentiviral human NOLC1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details