Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASHC2A Peptide - C-terminal region

WASHC2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM21A, FAM21B, bA98I6.1, bA56A21.1

UniProt

Q5SNT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WASHC2A Rabbit Polyclonal Antibody (orb55731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKVEAKSIFDDDMDDIFSTGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD274 antibody
STJ113753 100 µl

Anti-CD274 antibody

Sign In for Pricing
View Details
1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine
OR1004087-01 100 mg

1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine

Sign In for Pricing
View Details
1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine
OR1004087-02 250 mg

1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine

Sign In for Pricing
View Details
1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine
OR1004087-03 500 mg

1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine

Sign In for Pricing
View Details
1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine
OR1004087-04 1 g

1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine

Sign In for Pricing
View Details
1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine
OR1004087-05 2.5 g

1-Methyl-4- (2-methyl-4-nitrophenyl) piperazine

Sign In for Pricing
View Details