Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCAF1 Peptide - C-terminal region

TCAF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM115A

UniProt

Q9Y4C2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCAF1 Rabbit Polyclonal Antibody (orb326981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193870

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat
154578-01 10 µg

Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat

Sign In for Pricing
View Details
Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat
154578-02 50 µg

Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat

Sign In for Pricing
View Details
Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat
154578-03 200 µg

Fibroblast Growth Factor 1, Acidic (FGF1) Recombinant, Rat

Sign In for Pricing
View Details
SCFD1 Antibody
orb1315466 100 µL

SCFD1 Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus D-alanine aminotransferase (dat)
MBS1422001-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus D-alanine aminotransferase (dat)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus D-alanine aminotransferase (dat)
MBS1422001-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus D-alanine aminotransferase (dat)

Sign In for Pricing
View Details