FBLN7 Peptide - C-terminal region
FBLN7 Peptide - C-terminal region
Product Specifications
UniProt
Q53RD9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBLN7 Rabbit Polyclonal Antibody (orb587419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470853-500 1x 500 µL
P34 / cdk1 (POH-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042746-100 1x 100 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
