Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR2 Peptide - C-terminal region

ILDR2 Peptide - C-terminal region

Product Specifications

UniProt

E9PR23

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ILDR2 Rabbit Polyclonal Antibody (orb587462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBEGF, Recombinant, Human, aa63-148, His-Tag (Heparin-binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) discontinued
137075 50 µg

HBEGF, Recombinant, Human, aa63-148, His-Tag (Heparin-binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) discontinued

Sign In for Pricing
View Details
HSPC111 (NOP16 Nucleolar Protein Homolog (yeast), HSPC111, HSPC185) (AP) discontinued
247318-AP 100 µL

HSPC111 (NOP16 Nucleolar Protein Homolog (yeast), HSPC111, HSPC185) (AP) discontinued

Sign In for Pricing
View Details
AKR1A1 Protein Lysate (Rat) with C-HA Tag
11670036 100 µg

AKR1A1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RPS6KB1 Recombinant Antibody, PE Conjugated
bsm-62971R-PE-01 20 µL

RPS6KB1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
RPS6KB1 Recombinant Antibody, PE Conjugated
bsm-62971R-PE-02 100 µL

RPS6KB1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal BACE-2 Antibody [Alexa Fluor 750]
NBP1-77309AF750 0.1 mL

Rabbit Polyclonal BACE-2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details