Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR2 Peptide - C-terminal region

ILDR2 Peptide - C-terminal region

Product Specifications

UniProt

E9PR23

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ILDR2 Rabbit Polyclonal Antibody (orb587462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCRL5 Antibody
E19-4815 100 µg -100 µL

FCRL5 Antibody

Sign In for Pricing
View Details
NSA2 Polyclonal Antibody
orb616254-01 50 μL

NSA2 Polyclonal Antibody

Sign In for Pricing
View Details
NSA2 Polyclonal Antibody
orb616254-02 100 µL

NSA2 Polyclonal Antibody

Sign In for Pricing
View Details
Human focal adhesion kinase,FAK ELISA Kit
CN-04028H1 96T

Human focal adhesion kinase,FAK ELISA Kit

Sign In for Pricing
View Details
BMR1A Rabbit Polyclonal Antibody (FITC)
orb399673 100 µg

BMR1A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
2-Amino-N-isopropyl-3-phenyl-DL-propanamide
415391-01 100 mg

2-Amino-N-isopropyl-3-phenyl-DL-propanamide

Sign In for Pricing
View Details