Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS9 Peptide - C-terminal region

INTS9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPSF2L, INT9, RC74

UniProt

Q9NV88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS9 Rabbit Polyclonal Antibody (orb587465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060720

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Plectin (PLEC) Antibody Pair Kit (with Standard)
MBS2102012-01 5x 96 Tests

Human Plectin (PLEC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Plectin (PLEC) Antibody Pair Kit (with Standard)
MBS2102012-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Plectin (PLEC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Plectin (PLEC) Antibody Pair Kit (with Standard)
MBS2102012-03 10x 96 Tests

Human Plectin (PLEC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Plectin (PLEC) Antibody Pair Kit (with Standard)
MBS2102012-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Plectin (PLEC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
LINC00567 Protein Vector (Human) (pPB-C-His)
PV092042 500 ng

LINC00567 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ZNF365 Antibody
orb1333141 100 µg

ZNF365 Antibody

Sign In for Pricing
View Details