INTS9 Peptide - C-terminal region
INTS9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CPSF2L, INT9, RC74
UniProt
Q9NV88
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS9 Rabbit Polyclonal Antibody (orb587465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060720
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2504656-01 24 Tests
Human EAR3 (Eosinophil Associated Ribonuclease A family Member 3) ELISA Kit
Sign In for Pricing
View Details MBS2504656-02 48 Tests
Human EAR3 (Eosinophil Associated Ribonuclease A family Member 3) ELISA Kit
Sign In for Pricing
View Details MBS2504656-03 96 Tests
Human EAR3 (Eosinophil Associated Ribonuclease A family Member 3) ELISA Kit
Sign In for Pricing
View Details MBS2504656-04 5x 96 Tests
Human EAR3 (Eosinophil Associated Ribonuclease A family Member 3) ELISA Kit
Sign In for Pricing
View Details MBS2504656-05 10x 96 Tests
Human EAR3 (Eosinophil Associated Ribonuclease A family Member 3) ELISA Kit
Sign In for Pricing
View Details IGCNBGWBK3E50ML 50 mL
Innovative Grade US Origin Canine Beagle Whole Blood K3 EDTA 50ml
Sign In for Pricing
View Details