Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCC Peptide - middle region

IQCC Peptide - middle region

Product Specifications

Product Name Alternative

RP4-622L5.6

UniProt

F5H7T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCC Rabbit Polyclonal Antibody (orb587469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153514

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-36 Beta protein
CD00358-01 2 µg

Recombinant Mouse IL-36 Beta protein

Sign In for Pricing
View Details
Recombinant Mouse IL-36 Beta protein
CD00358-02 10 µg

Recombinant Mouse IL-36 Beta protein

Sign In for Pricing
View Details
Ddx3y Mouse qPCR Template Standard (NM_012008)
MK202423 1 Kit

Ddx3y Mouse qPCR Template Standard (NM_012008)

Sign In for Pricing
View Details
Ndufa11 (NM_027244) Mouse Tagged ORF Clone Lentiviral Particle
MR223785L4V 200 µL

Ndufa11 (NM_027244) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
EIF5A2 (NM_020390) Human Over-expression Lysate
E45H11149-2 20 µg

EIF5A2 (NM_020390) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund Small heat shock protein ibpA (ibpA)
MBS1135590-01 0.02 mg (E-Coli)

Recombinant Salmonella schwarzengrund Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details