Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCC Peptide - middle region

IQCC Peptide - middle region

Product Specifications

Product Name Alternative

RP4-622L5.6

UniProt

F5H7T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCC Rabbit Polyclonal Antibody (orb587469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153514

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF6L Rabbit Polyclonal Antibody (FITC)
orb2128443 100 µL

TAF6L Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HNRNPM Antibody
A33430-100UG 100 µg

HNRNPM Antibody

Sign In for Pricing
View Details
Myosin XVIIIa (H-10) : m-IgGκ BP-HRP Bundle
sc-522208 1 Kit

Myosin XVIIIa (H-10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Human 26S proteasome non-ATPase regulatory subunit 12 (PSMD12) ELISA Kit
GTR10367392 96 Well

Human 26S proteasome non-ATPase regulatory subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI5H5]
CF810456 100 µg

MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI5H5]

Sign In for Pricing
View Details
Rno-miR-103-3p miRNA Agomir
CMS0091-01 5 nmol

Rno-miR-103-3p miRNA Agomir

Sign In for Pricing
View Details