Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD1 Peptide - N-terminal region

JOSD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ508I15.2

UniProt

Q15040

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JOSD1 Rabbit Polyclonal Antibody (orb587475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055691

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK2 Antibody
KW-43851-01 50 μL

MARK2 Antibody

Sign In for Pricing
View Details
MARK2 Antibody
KW-43851-02 100 µL

MARK2 Antibody

Sign In for Pricing
View Details
MARK2 Antibody
KW-43851-03 1 mL

MARK2 Antibody

Sign In for Pricing
View Details
Human RAB30 activation kit by CRISPRa
GA109116 1 Kit

Human RAB30 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS808833 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
BDNF (NM_001709) Human Recombinant Protein
TP762769 50 µg

BDNF (NM_001709) Human Recombinant Protein

Sign In for Pricing
View Details