Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD1 Peptide - N-terminal region

JOSD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ508I15.2

UniProt

Q15040

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JOSD1 Rabbit Polyclonal Antibody (orb587475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055691

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLOC1S2 (NM_001282438) Human Tagged ORF Clone
RG235586 10 µg

BLOC1S2 (NM_001282438) Human Tagged ORF Clone

Sign In for Pricing
View Details
H4C13 (NM_003546) Human Recombinant Protein
TP760389 50 µg

H4C13 (NM_003546) Human Recombinant Protein

Sign In for Pricing
View Details
CXCR1 Human Recombinant Protein, Synthetic Nanodisc
TP721458M 100 µg

CXCR1 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Milbemycin Oxime (Mixture of Milbemycin Oxime A3 and Milbemycin Oxime A4, 80:20)
TRC-M344280-10MG 10 mg

Milbemycin Oxime (Mixture of Milbemycin Oxime A3 and Milbemycin Oxime A4, 80:20)

Sign In for Pricing
View Details
TWF2 (N-term) Rabbit Polyclonal Antibody
AP53503PU-N 400 µL

TWF2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA12 Antibody
KC-22760-01 50 μL

CA12 Antibody

Sign In for Pricing
View Details