Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD12 Peptide - C-terminal region

KBTBD12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLHDC6

UniProt

Q3ZCT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD12 Rabbit Polyclonal Antibody (orb327009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997218

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAVVNSEIYVLGGIGCVGQDKGQVRKCLDVVEIYNPDGDFWREGPPMPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMI1, NT (RMI1, C9orf76, RecQ-mediated genome instability protein 1, BLM-associated protein of 75kD, FAAP75)
MBS6012524-01 0.2 mL

RMI1, NT (RMI1, C9orf76, RecQ-mediated genome instability protein 1, BLM-associated protein of 75kD, FAAP75)

Sign In for Pricing
View Details
RMI1, NT (RMI1, C9orf76, RecQ-mediated genome instability protein 1, BLM-associated protein of 75kD, FAAP75)
MBS6012524-02 5x 0.2 mL

RMI1, NT (RMI1, C9orf76, RecQ-mediated genome instability protein 1, BLM-associated protein of 75kD, FAAP75)

Sign In for Pricing
View Details
NAT9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1392808 1.0 µg DNA

NAT9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Gomesin Antibody BIOTIN
MBS5400905-01 0.1 mg

Gomesin Antibody BIOTIN

Sign In for Pricing
View Details
Gomesin Antibody BIOTIN
MBS5400905-02 5x 0.1 mg

Gomesin Antibody BIOTIN

Sign In for Pricing
View Details
KLK7 sgRNA CRISPR Lentivector (Human) (Target 2)
K1160103 1.0 µg DNA

KLK7 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details