Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP104 Peptide - N-terminal region

CEP104 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GlyBP, KIAA0562

UniProt

O60308

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP104 Rabbit Polyclonal Antibody (orb587483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055519

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thioguanosine 5’-Phosphate-13C,15N2 triethylamine salt
TRC-T394876-25MG 25 mg

Thioguanosine 5’-Phosphate-13C,15N2 triethylamine salt

Sign In for Pricing
View Details
ZNF50 (ZSCAN22) (NM_181846) Human Recombinant Protein
TP760810 50 µg

ZNF50 (ZSCAN22) (NM_181846) Human Recombinant Protein

Sign In for Pricing
View Details
GAD65 Recombinant Rabbit monoclonal Antibody
HA751102 100 µL

GAD65 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)
KN217483LP 1 Kit

PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C3orf26 (CMSS1) Human Gene Knockout Kit (CRISPR)
KN400859 1 Kit

C3orf26 (CMSS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF808094 100 µg

POTEG Mouse Monoclonal Antibody [Clone ID: OTI2B5]

Sign In for Pricing
View Details