Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP104 Peptide - N-terminal region

CEP104 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GlyBP, KIAA0562

UniProt

O60308

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP104 Rabbit Polyclonal Antibody (orb587483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055519

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC645188 activation kit by CRISPRa
GA118753 1 Kit

Human LOC645188 activation kit by CRISPRa

Sign In for Pricing
View Details
DNALI1 Polyclonal Antibody
E-AB-67606-01 60 µL

DNALI1 Polyclonal Antibody

Sign In for Pricing
View Details
DNALI1 Polyclonal Antibody
E-AB-67606-02 120 µL

DNALI1 Polyclonal Antibody

Sign In for Pricing
View Details
DNALI1 Polyclonal Antibody
E-AB-67606-03 200 µL

DNALI1 Polyclonal Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF488A conjugate, 0.1mg/mL
BNC881009-500 1x 500 µL

CD66 (CEA) (C66/1009), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S-(-)-Nicotine Ditartrate Dihydrate
TRC-N417500-5G 5 g

S-(-)-Nicotine Ditartrate Dihydrate

Sign In for Pricing
View Details