KIAA1324L Peptide - N-terminal region
KIAA1324L Peptide - N-terminal region
Product Specifications
Product Name Alternative
EIG121L
UniProt
A8MWY0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIAA1324L Rabbit Polyclonal Antibody (orb587487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689961
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FSNKPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940096-100 1x 100 µL
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680708-500 1x 500 µL
Kappa Light Chain (TB28-2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402475-100 1x 100 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details