Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA2013 Peptide - C-terminal region

KIAA2013 Peptide - C-terminal region

Product Specifications

UniProt

Q8IYS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIAA2013 Rabbit Polyclonal Antibody (orb587494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612355

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQDPGLPFLFWFSVASLITLFHLFLFKLIYNEYCGPGAKPLFRSKEDPSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM122C (NM_138819) Human Untagged Clone
SC123159 10 µg

FAM122C (NM_138819) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_499 Protein (aa 1-163)
VAng-Lsx05001-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_499 Protein (aa 1-163)

Sign In for Pricing
View Details
Vaccinia virus
MBS320306-01 0.1 mg

Vaccinia virus

Sign In for Pricing
View Details
Vaccinia virus
MBS320306-02 1 mg

Vaccinia virus

Sign In for Pricing
View Details
Vaccinia virus
MBS320306-03 5x 1 mg

Vaccinia virus

Sign In for Pricing
View Details
Mouse Azin1 activation kit by CRISPRa
GA205685 1 Kit

Mouse Azin1 activation kit by CRISPRa

Sign In for Pricing
View Details