Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL30 Peptide - C-terminal region

KLHL30 Peptide - C-terminal region

Product Specifications

UniProt

Q0D2K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL30 Rabbit Polyclonal Antibody (orb587498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YHVEMEAYDTVRDTWTRHGALPRLWLYHGASTVFLDVSKWTQPSGPTQEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 anti-mouse CD186 (CXCR6)
GT05351 100 µg

PerCP/Cyanine5.5 anti-mouse CD186 (CXCR6)

Sign In for Pricing
View Details
FCHO1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0770008 1.0 µg DNA

FCHO1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TCF7 Antibody
MBS8513906-01 0.1 mg

TCF7 Antibody

Sign In for Pricing
View Details
TCF7 Antibody
MBS8513906-02 0.1 mL (AF635)

TCF7 Antibody

Sign In for Pricing
View Details
TCF7 Antibody
MBS8513906-03 0.1 mL (AF610)

TCF7 Antibody

Sign In for Pricing
View Details
TCF7 Antibody
MBS8513906-04 0.1 mL (AF405S)

TCF7 Antibody

Sign In for Pricing
View Details