KLHL33 Peptide - N-terminal region
KLHL33 Peptide - N-terminal region
Product Specifications
UniProt
A6NCF5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLHL33 Rabbit Polyclonal Antibody (orb587500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001103467
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRFGRMSTRELRRVRAAGLLPPLTPDLLHQLMVEADVPGQERRREPDRAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725129B 100 µL
Mouse/Rat Prealbumin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
#31042-20mL 2x 10 mL
Forget-Me-NotTM EvaGreen® qPCR Master Mix with ROX (2000 reactions)
Sign In for Pricing
View Details 
