Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL33 Peptide - N-terminal region

KLHL33 Peptide - N-terminal region

Product Specifications

UniProt

A6NCF5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL33 Rabbit Polyclonal Antibody (orb587500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103467

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRFGRMSTRELRRVRAAGLLPPLTPDLLHQLMVEADVPGQERRREPDRAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2W1 Antibody
8C12273-AAT 50 µg

Cytochrome P450 2W1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS803865 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Uric Acid-1,3-15N2
TRC-U829203-50MG 50 mg

Uric Acid-1,3-15N2

Sign In for Pricing
View Details
MYC Goat Polyclonal Antibody
AB0127-200 600 µg

MYC Goat Polyclonal Antibody

Sign In for Pricing
View Details
ATF2 pThr71/53 Rabbit Polyclonal Antibody
AP02332PU-S 50 µL

ATF2 pThr71/53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP6V1C2 Mouse Monoclonal Antibody [Clone ID: OTI6D5]
CF808256 100 µg

ATP6V1C2 Mouse Monoclonal Antibody [Clone ID: OTI6D5]

Sign In for Pricing
View Details