Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT34 Peptide - C-terminal region

KRT34 Peptide - C-terminal region

Product Specifications

UniProt

O76011

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT34 Rabbit Polyclonal Antibody (orb587505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_003403930

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV EP153R Protein, N-His
E55P8105 50 µg

Recombinant ASFV EP153R Protein, N-His

Sign In for Pricing
View Details
MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)
TMPK-00965-01 5 µg

MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)

Sign In for Pricing
View Details
MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)
TMPK-00965-02 10 µg

MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)

Sign In for Pricing
View Details
MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)
TMPK-00965-03 20 µg

MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)

Sign In for Pricing
View Details
MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)
TMPK-00965-04 50 µg

MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)

Sign In for Pricing
View Details
MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)
TMPK-00965-05 100 µg

MAdCAM-1 Protein, Human, Recombinant (aa 19-317, hFc)

Sign In for Pricing
View Details