Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT78 Peptide - middle region

KRT78 Peptide - middle region

Product Specifications

UniProt

Q8N1N4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT78 Rabbit Polyclonal Antibody (orb587507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABR Protein Vector (Human) (pPB-N-His)
PV060810 500 ng

ABR Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Acetyl-Histone H4 (Lys5) Antibody [N10C10]
F4698-20uL 20 µL

Acetyl-Histone H4 (Lys5) Antibody [N10C10]

Sign In for Pricing
View Details
SAE1 Antibody
MBS7117000-01 0.05 mg

SAE1 Antibody

Sign In for Pricing
View Details
SAE1 Antibody
MBS7117000-02 0.1 mg

SAE1 Antibody

Sign In for Pricing
View Details
SAE1 Antibody
MBS7117000-03 5x 0.1 mg

SAE1 Antibody

Sign In for Pricing
View Details
Rno-miR-466c-3p miRNA Inhibitor
orb1868505-01 10 nmol

Rno-miR-466c-3p miRNA Inhibitor

Sign In for Pricing
View Details