Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT78 Peptide - middle region

KRT78 Peptide - middle region

Product Specifications

UniProt

Q8N1N4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT78 Rabbit Polyclonal Antibody (orb587507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Histone H2B (AcK85) Antibody
MBS9233589-01 0.1 mL

Anti-Histone H2B (AcK85) Antibody

Sign In for Pricing
View Details
Anti-Histone H2B (AcK85) Antibody
MBS9233589-02 5x 0.1 mL

Anti-Histone H2B (AcK85) Antibody

Sign In for Pricing
View Details
HLA-DPB1 Protein Vector (Human) (pPM-C-HA)
PV019827 500 ng

HLA-DPB1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TJAP1 Antibody (N-term)
MBS9203068-01 0.08 mL

TJAP1 Antibody (N-term)

Sign In for Pricing
View Details
TJAP1 Antibody (N-term)
MBS9203068-02 0.4 mL

TJAP1 Antibody (N-term)

Sign In for Pricing
View Details
TJAP1 Antibody (N-term)
MBS9203068-03 5x 0.4 mL

TJAP1 Antibody (N-term)

Sign In for Pricing
View Details