KRT78 Peptide - middle region
KRT78 Peptide - middle region
Product Specifications
Product Name Alternative
K5B, Kb40
UniProt
Q8N1N4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KRT78 Rabbit Polyclonal Antibody (orb587508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775487
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I1878 96 Tests
Vacuolar protein sorting-associated protein 53 homolog (VPS53) Human ELISA Kit
Sign In for Pricing
View Details BKD17892-01 50 mg
3,4-Dichloro-2- (chloromethyl) pyridine hydrochloride
Sign In for Pricing
View Details BKD17892-02 0.5 g
3,4-Dichloro-2- (chloromethyl) pyridine hydrochloride
Sign In for Pricing
View Details