KRT78 Peptide - middle region
KRT78 Peptide - middle region
Product Specifications
Product Name Alternative
K5B, Kb40
UniProt
Q8N1N4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KRT78 Rabbit Polyclonal Antibody (orb587508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775487
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2573555 200 µL
Zebrafish crocc2 Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details M01204-1-Fluoro488 100 µg/Vial
Anti-Fibrinogen beta chain/FGB Antibody Picoband® (monoclonal, 6D12) Fluoro488 Conjugated
Sign In for Pricing
View Details