Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT79 Peptide - C-terminal region

KRT79 Peptide - C-terminal region

Product Specifications

Product Name Alternative

K6L, KRT6L

UniProt

Q5XKE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT79 Rabbit Polyclonal Antibody (orb587510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787028

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-3092 Primers
MPM00347 150 µL - 10 µM

mmu-miR-3092 Primers

Sign In for Pricing
View Details
Enkd1 (NM_001106180) Rat Untagged Clone
RN202934 10 µg

Enkd1 (NM_001106180) Rat Untagged Clone

Sign In for Pricing
View Details
Highly pure native CEA protein
MBS5308283-01 0.25 mg

Highly pure native CEA protein

Sign In for Pricing
View Details
Highly pure native CEA protein
MBS5308283-02 1 mg

Highly pure native CEA protein

Sign In for Pricing
View Details
Highly pure native CEA protein
MBS5308283-03 5x 1 mg

Highly pure native CEA protein

Sign In for Pricing
View Details
Olr1217 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7220003 1.0 µg DNA

Olr1217 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details