KRT79 Peptide - C-terminal region
KRT79 Peptide - C-terminal region
Product Specifications
Product Name Alternative
K6L, KRT6L
UniProt
Q5XKE5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KRT79 Rabbit Polyclonal Antibody (orb587510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_787028
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBL1-12363 0.1 mg
NKG2C/CD159c/KLRC2 Overexpression Lysate (Native) - (Dry Ice)
Sign In for Pricing
View Details GTR15147671 1 Vial
Lentiviral human UBE2F shRNA (UAS) - Lentiviral human UBE2F shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
MBS6212408-01 0.1 mL
MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Pro
Sign In for Pricing
View Details MBS6212408-02 5x 0.1 mL
MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Pro
Sign In for Pricing
View Details