Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS9C Peptide - C-terminal region

LGALS9C Peptide - C-terminal region

Product Specifications

UniProt

Q6DKI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGALS9C Rabbit Polyclonal Antibody (orb587515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035167

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBLCP1 Protein Vector (Rat) (pPB-N-His)
PV314183 500 ng

UBLCP1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal CCDC36 Antibody (OTI2D11) [Alexa Fluor 532]
NBP2-72504AF532 0.1 mL

Mouse Monoclonal CCDC36 Antibody (OTI2D11) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Polyclonal ITF46 Antibody
NBP3-10129-100ul 100 µL

Rabbit Polyclonal ITF46 Antibody

Sign In for Pricing
View Details
Recombinant IBV Hemagglutinin / HA Protein (aa 1-547) [His] (B/PHUKET/3073/2013)
VAng-Wyb7093-100g 100 µg

Recombinant IBV Hemagglutinin / HA Protein (aa 1-547) [His] (B/PHUKET/3073/2013)

Sign In for Pricing
View Details
DMTF1 Protein Vector (Mouse) (pPB-C-His)
PV172514 500 ng

DMTF1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cyclin G2 shRNA Plasmid (h)
sc-37597-SH 20 µg

Cyclin G2 shRNA Plasmid (h)

Sign In for Pricing
View Details