LGALS9C Peptide - C-terminal region
LGALS9C Peptide - C-terminal region
Product Specifications
UniProt
Q6DKI2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LGALS9C Rabbit Polyclonal Antibody (orb587515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035167
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Ly3787-inquire Inquire
Recombinant Caenorhabditis Elegans T05H10.6 Protein (aa 1-397)
Sign In for Pricing
View Details 
GTR15257410 1 Vial
Lentiviral mouse Rad54l shRNA (UAS) - Lentiviral mouse Rad54l shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
MBS6312240-01 0.2 mL
KCNA4, CT (KCNA4, KCNA4L, Potassium voltage-gated channel subfamily A member 4, HPCN2, Voltage-gated K(+) channel HuKII, Voltage-gated potassium channel HBK4, Voltage-gated potassium channel HK1, Voltage-gated potassium channel subunit Kv1.4) (Azide free)
Sign In for Pricing
View Details