Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1L Peptide - middle region

LMAN1L Peptide - middle region

Product Specifications

Product Name Alternative

ERGIC-53L, ERGL

UniProt

Q9HAT1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMAN1L Rabbit Polyclonal Antibody (orb587516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSEPSPEVPPQPFLEMQQLRLARQLEGLWARLGLGTREDVTPKSDSEAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Netrin receptor DCC DCC Antibody Picoband®, Carrier-free
PA1910-carrier-free 100 µg/Vial

Anti-Netrin receptor DCC DCC Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
FBXO9 3'UTR Luciferase Stable Cell Line
TU007778 1.0 mL

FBXO9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CDK4 Antibody (YA5223, Mouse)
HY-P85531 1 Each

CDK4 Antibody (YA5223, Mouse)

Sign In for Pricing
View Details
Human SEMA3F siRNA
abx932839-01 15 nmol

Human SEMA3F siRNA

Sign In for Pricing
View Details
Human SEMA3F siRNA
abx932839-02 30 nmol

Human SEMA3F siRNA

Sign In for Pricing
View Details
Recombinant Human Oxidized Low Density Lipoprotein Receptor 1, HEK
MBS141176-01 0.002 mg

Recombinant Human Oxidized Low Density Lipoprotein Receptor 1, HEK

Sign In for Pricing
View Details