Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1L Peptide - middle region

LMAN1L Peptide - middle region

Product Specifications

Product Name Alternative

ERGIC-53L, ERGL

UniProt

Q9HAT1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMAN1L Rabbit Polyclonal Antibody (orb587516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSEPSPEVPPQPFLEMQQLRLARQLEGLWARLGLGTREDVTPKSDSEAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Intercellular Adhesion Molecule 4 (ICAM4) Antibody
abx103617-01 100 µL

Intercellular Adhesion Molecule 4 (ICAM4) Antibody

Sign In for Pricing
View Details
Intercellular Adhesion Molecule 4 (ICAM4) Antibody
abx103617-02 200 µL

Intercellular Adhesion Molecule 4 (ICAM4) Antibody

Sign In for Pricing
View Details
Intercellular Adhesion Molecule 4 (ICAM4) Antibody
abx103617-03 1 mL

Intercellular Adhesion Molecule 4 (ICAM4) Antibody

Sign In for Pricing
View Details
Zfp521 Mouse shRNA Plasmid (Locus ID 225207)
TR506694 1 Kit

Zfp521 Mouse shRNA Plasmid (Locus ID 225207)

Sign In for Pricing
View Details
ORP150 Antibody
49951-01 50 µL

ORP150 Antibody

Sign In for Pricing
View Details
ORP150 Antibody
49951-02 100 µL

ORP150 Antibody

Sign In for Pricing
View Details