Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRIT3 Peptide - middle region

LRIT3 Peptide - middle region

Product Specifications

UniProt

Q3SXY7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRIT3 Rabbit Polyclonal Antibody (orb327022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xylt2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7095204 1.0 µg DNA

Xylt2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
UBE2N Antibody
45234-01 50 µL

UBE2N Antibody

Sign In for Pricing
View Details
UBE2N Antibody
45234-02 100 µL

UBE2N Antibody

Sign In for Pricing
View Details
SIGL9 Polyclonal Antibody
UB-GEN-7105 100 µL

SIGL9 Polyclonal Antibody

Sign In for Pricing
View Details
Factor V Light Chain Monoclonal Antibody
MBS190150-01 0.25 mg

Factor V Light Chain Monoclonal Antibody

Sign In for Pricing
View Details
Factor V Light Chain Monoclonal Antibody
MBS190150-02 5x 0.25 mg

Factor V Light Chain Monoclonal Antibody

Sign In for Pricing
View Details